Lineage for d5mrqa_ (5mrq A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2150158Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2150159Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2150179Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142690] (11 PDB entries)
    Uniprot P69834 75-300
  8. 2150190Domain d5mrqa_: 5mrq A: [336831]
    automated match to d1w77a1
    complexed with cd, trs; mutant

Details for d5mrqa_

PDB Entry: 5mrq (more details), 2.2 Å

PDB Description: arabidopsis thaliana ispd asp262ala mutant
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic

SCOPe Domain Sequences for d5mrqa_:

Sequence, based on SEQRES records: (download)

>d5mrqa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
ksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdi
feeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkd
gsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseg
levtdavsiveylkhpvyvsqgsytnikvttpddlllaerils

Sequence, based on observed residues (ATOM records): (download)

>d5mrqa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
ksvsvillagmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyeesid
vdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavgaavl
gvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseglevtdavsi
veylkhpvyvsqgsytnikvttpddlllaerils

SCOPe Domain Coordinates for d5mrqa_:

Click to download the PDB-style file with coordinates for d5mrqa_.
(The format of our PDB-style files is described here.)

Timeline for d5mrqa_: