Lineage for d2kfna1 (2kfn A:324-518)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837107Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 837155Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 837157Domain d2kfna1: 2kfn A:324-518 [33682]
    Other proteins in same PDB: d2kfna2
    protein/DNA complex; complexed with mg, mn, s, zn

Details for d2kfna1

PDB Entry: 2kfn (more details), 2.03 Å

PDB Description: klenow fragment with bridging-sulfur substrate and manganese
PDB Compounds: (A:) klenow fragment of DNA polymerase I

SCOP Domain Sequences for d2kfna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kfna1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d2kfna1:

Click to download the PDB-style file with coordinates for d2kfna1.
(The format of our PDB-style files is described here.)

Timeline for d2kfna1: