Lineage for d1kfsa1 (1kfs A:324-518)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374442Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1374493Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 1374494Domain d1kfsa1: 1kfs A:324-518 [33681]
    Other proteins in same PDB: d1kfsa2
    protein/DNA complex; complexed with mg, zn; mutant

Details for d1kfsa1

PDB Entry: 1kfs (more details), 2.1 Å

PDB Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex
PDB Compounds: (A:) protein (DNA polymerase I klenow fragment (e.c.2.7.7.7))

SCOPe Domain Sequences for d1kfsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOPe Domain Coordinates for d1kfsa1:

Click to download the PDB-style file with coordinates for d1kfsa1.
(The format of our PDB-style files is described here.)

Timeline for d1kfsa1: