SCOPe 2.08: Domain d5knsb_: 5kns B:

Lineage for d5knsb_ (5kns B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [336800] (6 PDB entries)

8. Domain d5knsb_: 5kns B: [336809]
   automated match to d1g9sa_
   complexed with 3l7, epe, mg

Details for d5knsb_

PDB Entry: 5kns, 2.79 Å

PDB Description: e coli hypoxanthine guanine phosphoribosyltransferase in complexed with 9-[(n-phosphonoethyl-n-phosphonoethoxyethyl)-2- aminoethyl]hypoxanthine

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5knsb_:

Sequence, based on SEQRES records:

>d5knsb_ c.61.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
dmkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvs
hevdfmtassygsgmsttrdvkilkdldedirgkdvlivediidsgntlskvreilslre
pkslaictlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Sequence, based on observed residues (ATOM records):

>d5knsb_ c.61.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
dmkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvs
hevdfmtassttrdvkilkdldedirgkdvlivediidsgntlskvreilslrepkslai
ctlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Timeline for d5knsb_:

• d5knsb_ first appeared in SCOPe 2.06
  
• d5knsb_ appears in SCOPe 2.07