Lineage for d1b7ea_ (1b7e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124325Family c.55.3.4: Transposase inhibitor (Tn5 transposase) [53115] (1 protein)
  6. 2124326Protein Transposase inhibitor (Tn5 transposase) [53116] (1 species)
    contains additional all-alpha subdomains in both N- and C-terminal regions
  7. 2124327Species Escherichia coli [TaxId:562] [53117] (6 PDB entries)
  8. 2124333Domain d1b7ea_: 1b7e A: [33680]
    complexed with tpt

Details for d1b7ea_

PDB Entry: 1b7e (more details), 2.9 Å

PDB Description: transposase inhibitor
PDB Compounds: (A:) protein (transposase inhibitor protein from tn5)

SCOPe Domain Sequences for d1b7ea_:

Sequence, based on SEQRES records: (download)

>d1b7ea_ c.55.3.4 (A:) Transposase inhibitor (Tn5 transposase) {Escherichia coli [TaxId: 562]}
saeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgsiqdksrgwwvhsv
llleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrmgsmmsnviavcdr
eadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelggyqisipqkgvvdk
rgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetplkwllltsepvesl
aqalrvidiythrwrieefhkawktgagaerqrmeepdnlermvsilsfvavrllqlres
ftlpqalraqgllkeaehvesqsaetvltpdecqllgyldkgkrkrkekgslqwaymaia
rlggfmdskrtgiaswgalwegwealqskldgflaakdlmaq

Sequence, based on observed residues (ATOM records): (download)

>d1b7ea_ c.55.3.4 (A:) Transposase inhibitor (Tn5 transposase) {Escherichia coli [TaxId: 562]}
saeairkagamqtvklaqefpellaiedttslsyrwwvhsvllleattfrtvgllhqeww
mrpddpadadekesgkwlaaaatsrlrmgsmmsnviavcdreadihaylqdklahnerfv
vrskhprkdvesglylydhlknqpelggyqisipqkgvrparkaslslrsgritlkqgni
tlnavlaeeinppkgetplkwllltsepveslaqalrvidiythrwrieefhkawktgag
aerqrmpdnlermvsilsfvavrllqlresftlpqalraqgllkeaehvesqsaetvltp
decqllgyldkgkrkrkekgslqwaymaiarlggfmdskrtgiaswgalwegwealqskl
dgflaakdlmaq

SCOPe Domain Coordinates for d1b7ea_:

Click to download the PDB-style file with coordinates for d1b7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1b7ea_: