| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) ![]() automatically mapped to Pfam PF02935 |
| Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81424] (50 PDB entries) |
| Domain d5xdqy_: 5xdq Y: [336792] Other proteins in same PDB: d5xdqa_, d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqz_ automated match to d1v54l_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 5xdq (more details), 1.77 Å
SCOPe Domain Sequences for d5xdqy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdqy_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
Timeline for d5xdqy_:
View in 3DDomains from other chains: (mouse over for more information) d5xdqa_, d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqz_ |