SCOPe 2.08: Domain d5xdqe_: 5xdq E:

Lineage for d5xdqe_ (5xdq E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)

8. Domain d5xdqe_: 5xdq E: [336785]
   Other proteins in same PDB: d5xdqa_, d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_
   automated match to d1v54e_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d5xdqe_

PDB Entry: 5xdq, 1.77 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state with ph 7.3 at 1.77 angstrom resolution

PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5xdqe_:

Sequence; same for both SEQRES and ATOM records:

>d5xdqe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d5xdqe_:

• d5xdqe_ first appeared in SCOPe 2.06
  
• d5xdqe_ appears in SCOPe 2.07