Lineage for d1bcmb2 (1bcm B:258-480)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25352Family c.55.3.3: mu transposase, core domain [53112] (1 protein)
  6. 25353Protein mu transposase, core domain [53113] (1 species)
  7. 25354Species Bacteriophage mu [TaxId:10677] [53114] (2 PDB entries)
  8. 25357Domain d1bcmb2: 1bcm B:258-480 [33678]
    Other proteins in same PDB: d1bcma1, d1bcmb1

Details for d1bcmb2

PDB Entry: 1bcm (more details), 2.8 Å

PDB Description: bacteriophage mu transposase core domain with 2 monomers per asymmetric unit

SCOP Domain Sequences for d1bcmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcmb2 c.55.3.3 (B:258-480) mu transposase, core domain {Bacteriophage mu}
ehldamqwingdgylhnvfvrwfngdvirpktwfwqdvktrkilgwrcdvsenidsirls
fmdvvtrygipedfhitidntrgaankwltggapnryrfkvkeddpkglfllmgakmhwt
svvagkgwgqakpverafgvggleeyvdkhpalagaytgpnpqakpdnygdravdaelfl
ktlaegvamfnartgretemcggklsfddvfereyartivrkp

SCOP Domain Coordinates for d1bcmb2:

Click to download the PDB-style file with coordinates for d1bcmb2.
(The format of our PDB-style files is described here.)

Timeline for d1bcmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bcmb1