SCOPe 2.06: Domain d1bcma2: 1bcm A:257-480

Lineage for d1bcma2 (1bcm A:257-480)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.3: mu transposase, core domain [53112] (1 protein)
   automatically mapped to Pfam PF02914

6. Protein mu transposase, core domain [53113] (1 species)

7. Species Bacteriophage Mu [TaxId:10677] [53114] (2 PDB entries)

8. Domain d1bcma2: 1bcm A:257-480 [33677]
   Other proteins in same PDB: d1bcma1, d1bcmb1

Details for d1bcma2

PDB Entry: 1bcm, 2.8 Å

PDB Description: bacteriophage mu transposase core domain with 2 monomers per asymmetric unit

PDB Compounds: (A:) bacteriophage mu transposase

SCOPe Domain Sequences for d1bcma2:

Sequence; same for both SEQRES and ATOM records:

>d1bcma2 c.55.3.3 (A:257-480) mu transposase, core domain {Bacteriophage Mu [TaxId: 10677]}
vehldamqwingdgylhnvfvrwfngdvirpktwfwqdvktrkilgwrcdvsenidsirl
sfmdvvtrygipedfhitidntrgaankwltggapnryrfkvkeddpkglfllmgakmhw
tsvvagkgwgqakpverafgvggleeyvdkhpalagaytgpnpqakpdnygdravdaelf
lktlaegvamfnartgretemcggklsfddvfereyartivrkp

Timeline for d1bcma2:

• d1bcma2 first appeared (with stable ids) in SCOP 1.55
  
• d1bcma2 appears in SCOPe 2.05
  
• d1bcma2 appears in SCOPe 2.07
  
• d1bcma2 appears in the current release, SCOPe 2.08