Lineage for d5w71b_ (5w71 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2472267Species Bacillus circulans [TaxId:1397] [187516] (3 PDB entries)
  8. 2472271Domain d5w71b_: 5w71 B: [336763]
    automated match to d2c7ta_
    complexed with 9ym, cl, plp

Details for d5w71b_

PDB Entry: 5w71 (more details), 2.1 Å

PDB Description: x-ray structure of btrr from bacillus circulans in the presence of the 2-dos external aldimine
PDB Compounds: (B:) L-glutamine:2-deoxy-scyllo-inosose aminotransferase

SCOPe Domain Sequences for d5w71b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w71b_ c.67.1.0 (B:) automated matches {Bacillus circulans [TaxId: 1397]}
hwpewpqhsdrtrrkieevfqsnrwaisgywtgeesmerkfakafadfngvpycvpttsg
stalmlalealgigegdevivpsltwiatatavlnvnalpvfvdveadtycidpqliksa
itdktkaiipvhlfgsmanmdeineiaqehnlfviedcaqshgsvwnnqragtigdigaf
scqqgkvltageggiivtknprlfeliqqlradsrvycddsselmhgdmqlvkkgdiqgs
nyclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsrqtyygy
vfrfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknrylksvrkt
eaywrglhypvserasgqsivihhaillaepshlsllvdavaelarkfc

SCOPe Domain Coordinates for d5w71b_:

Click to download the PDB-style file with coordinates for d5w71b_.
(The format of our PDB-style files is described here.)

Timeline for d5w71b_: