SCOPe 2.08: Domain d5xvub_: 5xvu B:

Lineage for d5xvub_ (5xvu B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [336753] (1 PDB entry)

8. Domain d5xvub_: 5xvu B: [336762]
   automated match to d3q9za_
   complexed with atp, cl, edo, peg, so4

Details for d5xvub_

PDB Entry: 5xvu, 3 Å

PDB Description: crystal structure of the protein kinase ck2 catalytic domain from plasmodium falciparum bound to atp

PDB Compounds: (B:) Casein kinase 2, alpha subunit

SCOPe Domain Sequences for d5xvub_:

Sequence; same for both SEQRES and ATOM records:

>d5xvub_ d.144.1.7 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ipkfyadvnihkpkeyydydnlelqwnkpnryeimkkigrgkysevfngydtecnrpcai
kvlkpvkkkkikreikilqnlnggpniiklldivkdpvtktpslifeyinnidfktlypk
ftdkdiryyiyqilkaldychsqgimhrdvkphnimidhenrqirliswglaefyhpgqe
ynvrvasryykgpellidlqlydysldiwslgcmlagmifkkepffcghdnydqlvkiak
vlgtedlhaylkkyniklkphylnilgeyerkpwshfltqsnidiakdevidlidkmliy
dhakriapkeamehpyfrevr

Timeline for d5xvub_:

• d5xvub_ first appeared in SCOPe 2.06
  
• d5xvub_ appears in SCOPe 2.07