Lineage for d5w8pb1 (5w8p B:13-378)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902515Species Mycobacterium abscessus [TaxId:561007] [336741] (1 PDB entry)
  8. 2902517Domain d5w8pb1: 5w8p B:13-378 [336760]
    Other proteins in same PDB: d5w8pa2, d5w8pb2
    automated match to d2pl5a1
    complexed with gol, k, po4

Details for d5w8pb1

PDB Entry: 5w8p (more details), 1.69 Å

PDB Description: homoserine transacetylase metx from mycobacterium abscessus
PDB Compounds: (B:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d5w8pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w8pb1 c.69.1.0 (B:13-378) automated matches {Mycobacterium abscessus [TaxId: 561007]}
alpqgdeiayvpigsitlesgaviddvtiavqswgelsprrdnvvfvchaltadshvvgp
agpdhitggwwegiigpgaaidtdhwcavatnvlggcrgttgptslardgkpwgsrfpev
svrdqvnadvaalaqlgitevaavvggsmggaralewavmhpdavraalvlavgaratgd
qigtqstqiaaiqtdpdwqggdyhgsgrspgkglnlarriahltyrgeveldtrfgndpq
vgpdgpedpwadgryavqsylehqgnkfvrrfdagsyvilteslnrhdvgrgrggvekal
rgcpvpvvvggitsdrlyplrlqeeladllpgctglrvvesvhghdafliefdavselvr
etlala

SCOPe Domain Coordinates for d5w8pb1:

Click to download the PDB-style file with coordinates for d5w8pb1.
(The format of our PDB-style files is described here.)

Timeline for d5w8pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w8pb2