Lineage for d1bcoa2 (1bco A:258-480)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494296Family c.55.3.3: mu transposase, core domain [53112] (1 protein)
    automatically mapped to Pfam PF02914
  6. 2494297Protein mu transposase, core domain [53113] (1 species)
  7. 2494298Species Bacteriophage Mu [TaxId:10677] [53114] (2 PDB entries)
  8. 2494299Domain d1bcoa2: 1bco A:258-480 [33676]
    Other proteins in same PDB: d1bcoa1

Details for d1bcoa2

PDB Entry: 1bco (more details), 2.4 Å

PDB Description: bacteriophage mu transposase core domain
PDB Compounds: (A:) bacteriophage mu transposase

SCOPe Domain Sequences for d1bcoa2:

Sequence, based on SEQRES records: (download)

>d1bcoa2 c.55.3.3 (A:258-480) mu transposase, core domain {Bacteriophage Mu [TaxId: 10677]}
ehldamqwingdgylhnvfvrwfngdvirpktwfwqdvktrkilgwrcdvsenidsirls
fmdvvtrygipedfhitidntrgaankwltggapnryrfkvkeddpkglfllmgakmhwt
svvagkgwgqakpverafgvggleeyvdkhpalagaytgpnpqakpdnygdravdaelfl
ktlaegvamfnartgretemcggklsfddvfereyartivrkp

Sequence, based on observed residues (ATOM records): (download)

>d1bcoa2 c.55.3.3 (A:258-480) mu transposase, core domain {Bacteriophage Mu [TaxId: 10677]}
ehldamqwingdgylhnvfvrwfngdvirpktwfwqdvktrkilgwrcdvsenidsirls
fmdvvtrygipedfhitidntrgaankwltggapnryrfkvkeddpkglfllmgakmhwt
svvagkgwgqakpverafgvggleeyvdkhpalagaytgpygdravdaelflktlaegva
mfnartgretemcggklsfddvfereyartivrkp

SCOPe Domain Coordinates for d1bcoa2:

Click to download the PDB-style file with coordinates for d1bcoa2.
(The format of our PDB-style files is described here.)

Timeline for d1bcoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bcoa1