Lineage for d5w3eb_ (5w3e B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410109Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2410227Protein Rhinovirus coat proteins [49670] (5 species)
  7. 2410280Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (33 PDB entries)
  8. 2410290Domain d5w3eb_: 5w3e B: [336744]
    Other proteins in same PDB: d5w3ee_, d5w3eg_
    automated match to d1ncqc_

Details for d5w3eb_

PDB Entry: 5w3e (more details), 2.53 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (33 degrees celsius, molar ratio 1:3, full particle)
PDB Compounds: (B:) viral protein 3

SCOPe Domain Sequences for d5w3eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3eb_ b.121.4.1 (B:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

SCOPe Domain Coordinates for d5w3eb_:

Click to download the PDB-style file with coordinates for d5w3eb_.
(The format of our PDB-style files is described here.)

Timeline for d5w3eb_: