Lineage for d1c6vc_ (1c6v C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606866Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1606867Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 1606975Species Simian immunodeficiency virus [TaxId:11723] [53111] (1 PDB entry)
  8. 1606978Domain d1c6vc_: 1c6v C: [33674]
    Other proteins in same PDB: d1c6vx_
    mutant

Details for d1c6vc_

PDB Entry: 1c6v (more details), 3 Å

PDB Description: siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
PDB Compounds: (C:) protein (siv integrase)

SCOPe Domain Sequences for d1c6vc_:

Sequence, based on SEQRES records: (download)

>d1c6vc_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
ivlmavhcmnhkrrggigdmtpaerlinmitte

Sequence, based on observed residues (ATOM records): (download)

>d1c6vc_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
tdnganfasqevkmvawwagiehtfgveamnhhlknqidrireqansvetivlmavhcmn
hkrrggigdmtpaerlinmitte

SCOPe Domain Coordinates for d1c6vc_:

Click to download the PDB-style file with coordinates for d1c6vc_.
(The format of our PDB-style files is described here.)

Timeline for d1c6vc_: