Lineage for d1c6vb_ (1c6v B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72110Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 72111Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 72167Species Simian immunodeficiency virus [53111] (1 PDB entry)
  8. 72169Domain d1c6vb_: 1c6v B: [33673]
    Other proteins in same PDB: d1c6vx_

Details for d1c6vb_

PDB Entry: 1c6v (more details), 3 Å

PDB Description: siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)

SCOP Domain Sequences for d1c6vb_:

Sequence, based on SEQRES records: (download)

>d1c6vb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus}
nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
ivlmavhcmnhkrrggigdmtpaerlinmitte

Sequence, based on observed residues (ATOM records): (download)

>d1c6vb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Simian immunodeficiency virus}
nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
krrggigdmtpaerlinmitte

SCOP Domain Coordinates for d1c6vb_:

Click to download the PDB-style file with coordinates for d1c6vb_.
(The format of our PDB-style files is described here.)

Timeline for d1c6vb_: