SCOPe 2.08: Domain d5w3ob_: 5w3o B:

Lineage for d5w3ob_ (5w3o B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Human rhinovirus 14 [TaxId:12131] [258112] (4 PDB entries)

8. Domain d5w3ob_: 5w3o B: [336729]
   Other proteins in same PDB: d5w3od_, d5w3oe_
   automated match to d1rhi3_

Details for d5w3ob_

PDB Entry: 5w3o, 3.01 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (33 degrees celsius, molar ratio 1:3, empty particle)

PDB Compounds: (B:) viral protein 3

SCOPe Domain Sequences for d5w3ob_:

Sequence, based on SEQRES records:

>d5w3ob_ b.121.4.1 (B:) automated matches {Human rhinovirus 14 [TaxId: 12131]}
ptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnnthtkd
evnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgpal
ssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdtyt
sagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqt

Sequence, based on observed residues (ATOM records):

>d5w3ob_ b.121.4.1 (B:) automated matches {Human rhinovirus 14 [TaxId: 12131]}
ptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnnthtkd
evnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgpal
ssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvtsagflscwyq
tslilppettgqvyllsfisacpdfklrlmkdtqt

Timeline for d5w3ob_:

• d5w3ob_ first appeared in SCOPe 2.06
  
• d5w3ob_ appears in SCOPe 2.07