Lineage for d5w3mg_ (5w3m G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744776Domain d5w3mg_: 5w3m G: [336726]
    Other proteins in same PDB: d5w3ma_, d5w3mb_, d5w3me_
    automated match to d1a7nl_

Details for d5w3mg_

PDB Entry: 5w3m (more details), 2.26 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (33 degrees celsius, molar ratio 1:1, full particle)
PDB Compounds: (G:) C5 antibody variable light domain

SCOPe Domain Sequences for d5w3mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3mg_ b.1.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaalsaaagatvaatcrasgnihnalawyqqkagkspqllvyaaaalaagvps
rfsgsgsgtayalainslaaddfgayycqhfwstpytfgggtkleik

SCOPe Domain Coordinates for d5w3mg_:

Click to download the PDB-style file with coordinates for d5w3mg_.
(The format of our PDB-style files is described here.)

Timeline for d5w3mg_: