Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d5w3mg_: 5w3m G: [336726] Other proteins in same PDB: d5w3ma_, d5w3mb_, d5w3me_ automated match to d1a7nl_ |
PDB Entry: 5w3m (more details), 2.26 Å
SCOPe Domain Sequences for d5w3mg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w3mg_ b.1.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaalsaaagatvaatcrasgnihnalawyqqkagkspqllvyaaaalaagvps rfsgsgsgtayalainslaaddfgayycqhfwstpytfgggtkleik
Timeline for d5w3mg_: