SCOPe 2.06: Domain d5w3lb_: 5w3l B:

Lineage for d5w3lb_ (5w3l B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (33 PDB entries)

8. Domain d5w3lb_: 5w3l B: [336722]
   Other proteins in same PDB: d5w3le_, d5w3lg_
   automated match to d1ncqc_

Details for d5w3lb_

PDB Entry: 5w3l, 2.71 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (4 degrees celsius, molar ratio 1:3, full particle)

PDB Compounds: (B:) viral protein 3

SCOPe Domain Sequences for d5w3lb_:

Sequence; same for both SEQRES and ATOM records:

>d5w3lb_ b.121.4.1 (B:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

Timeline for d5w3lb_:

• d5w3lb_ is new in SCOPe 2.06-stable
  
• d5w3lb_ appears in SCOPe 2.07
  
• d5w3lb_ appears in the current release, SCOPe 2.08