Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
Protein Retroviral integrase, catalytic domain [53108] (5 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries) |
Domain d1ex4b2: 1ex4 B:55-222 [33671] Other proteins in same PDB: d1ex4a1, d1ex4b1 complexed with cps |
PDB Entry: 1ex4 (more details), 2.8 Å
SCOPe Domain Sequences for d1ex4b2:
Sequence, based on SEQRES records: (download)
>d1ex4b2 c.55.3.2 (B:55-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} dsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktih tdngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkt avqmavfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqn
>d1ex4b2 c.55.3.2 (B:55-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} dsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktih tdngsnftgatvraacdwagikqvvesmnkelkkiigqvrdqaehlktavqmavfihnkk rkggiggysagerivdiiatdiqtkelqkqitkiqn
Timeline for d1ex4b2: