Lineage for d1ex4a2 (1ex4 A:56-222)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25292Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 25293Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 25294Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (14 PDB entries)
  8. 25319Domain d1ex4a2: 1ex4 A:56-222 [33670]
    Other proteins in same PDB: d1ex4a1, d1ex4b1

Details for d1ex4a2

PDB Entry: 1ex4 (more details), 2.8 Å

PDB Description: hiv-1 integrase catalytic core and c-terminal domain

SCOP Domain Sequences for d1ex4a2:

Sequence, based on SEQRES records: (download)

>d1ex4a2 c.55.3.2 (A:56-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqn

Sequence, based on observed residues (ATOM records): (download)

>d1ex4a2 c.55.3.2 (A:56-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipqsqgvvesmnkelkkiigqvrdqaehlktavqm
avfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqn

SCOP Domain Coordinates for d1ex4a2:

Click to download the PDB-style file with coordinates for d1ex4a2.
(The format of our PDB-style files is described here.)

Timeline for d1ex4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ex4a1