Lineage for d1ex4a2 (1ex4 A:56-222)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)
  8. Domain d1ex4a2: 1ex4 A:56-222 [33670]
    Other proteins in same PDB: d1ex4a1, d1ex4b1
    complexed with cps

Details for d1ex4a2

PDB Entry: 1ex4 (more details), 2.8 Å

PDB Description: hiv-1 integrase catalytic core and c-terminal domain
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1ex4a2:

Sequence, based on SEQRES records: (download)

>d1ex4a2 c.55.3.2 (A:56-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqn

Sequence, based on observed residues (ATOM records): (download)

>d1ex4a2 c.55.3.2 (A:56-222) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftgatvraacdwagikqedgipqsqgvvesmnkelkkiigqvrdqaehlktavqm
avfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqn

SCOPe Domain Coordinates for d1ex4a2 are not available.

Timeline for d1ex4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ex4a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ex4b1, d1ex4b2