Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein automated matches [226883] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries) |
Domain d5mvvg_: 5mvv G: [336696] Other proteins in same PDB: d5mvva1, d5mvva2 automated match to d4cbug_ complexed with atp, ca, cd, scn |
PDB Entry: 5mvv (more details), 1.4 Å
SCOPe Domain Sequences for d5mvvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mvvg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mvvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqyd lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkgg vasgf
Timeline for d5mvvg_: