Lineage for d5iu0b2 (5iu0 B:150-475)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424105Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2424106Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2424311Protein automated matches [226984] (14 species)
    not a true protein
  7. 2424482Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [336637] (1 PDB entry)
  8. 2424484Domain d5iu0b2: 5iu0 B:150-475 [336692]
    Other proteins in same PDB: d5iu0a1, d5iu0b1, d5iu0i_, d5iu0j_
    automated match to d1gk8a1
    complexed with cap, edo, mg

Details for d5iu0b2

PDB Entry: 5iu0 (more details), 1.5 Å

PDB Description: rubisco from arabidopsis thaliana
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5iu0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iu0b2 c.1.14.1 (B:150-475) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemikravfarelgvpivmhdy
ltggftantslshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhihag
tvvgklegdrestlgfvdllrddyvekdrsrgifftqdwvslpgvlpvasggihvwhmpa
lteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlavegneiireac
kwspelaaacevwkeitfnfptidkl

SCOPe Domain Coordinates for d5iu0b2:

Click to download the PDB-style file with coordinates for d5iu0b2.
(The format of our PDB-style files is described here.)

Timeline for d5iu0b2: