Lineage for d5q0ea_ (5q0e A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798248Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries)
  8. 2798343Domain d5q0ea_: 5q0e A: [336689]
    automated match to d1p57b_
    complexed with 9fd, edo, so4

Details for d5q0ea_

PDB Entry: 5q0e (more details), 2.12 Å

PDB Description: factor xia in complex with the inhibitor methyl [(4s,8s)-8-({(2e)-3- [5-chloro-2-(1h-tetrazol-1-yl)phenyl]prop-2-enoyl}amino)-4-methyl-2- oxo-1,3,4,5,6,7,8,10-octahydro-2h-12,9-(azeno)-1,10- benzodiazacyclotetradecin-15-yl]carbamate
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d5q0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5q0ea_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d5q0ea_:

Click to download the PDB-style file with coordinates for d5q0ea_.
(The format of our PDB-style files is described here.)

Timeline for d5q0ea_: