SCOPe 2.08: Domain d5ksgb1: 5ksg B:35-443

Lineage for d5ksgb1 (5ksg B:35-443)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (6 species)
   only the N-terminal CCP-like domain binds heme

7. Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)

8. Domain d5ksgb1: 5ksg B:35-443 [336669]
   automated match to d3n3oa1
   complexed with cl, hem, mpd, na, niz, oxy, po4

Details for d5ksgb1

PDB Entry: 5ksg, 1.62 Å

PDB Description: crystal structure of the w153f variant of catalase-peroxidase from b. pseudomallei treated with isoniazid

PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d5ksgb1:

Sequence; same for both SEQRES and ATOM records:

>d5ksgb1 a.93.1.3 (B:35-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 320372]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllfp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

Timeline for d5ksgb1:

• d5ksgb1 first appeared in SCOPe 2.06
  
• d5ksgb1 appears in SCOPe 2.07