| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.17: occludin/ELL-like [144292] (2 families) ![]() antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731) |
| Family h.4.17.0: automated matches [329497] (1 protein) not a true family |
| Protein automated matches [329498] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [329499] (4 PDB entries) |
| Domain d5n7kb1: 5n7k B:439-551 [336660] Other proteins in same PDB: d5n7kb2, d5n7kc2, d5n7kd2 automated match to d1wpaa1 |
PDB Entry: 5n7k (more details), 2.81 Å
SCOPe Domain Sequences for d5n7kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n7kb1 h.4.17.0 (B:439-551) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpdyvakypviqtddererykavfqdqfseykelsaevqavlrkfdeldavmsrlphhse
srqeherisriheefkkkkndptflekkercdylknklshikqriqeydkvmn
Timeline for d5n7kb1: