Lineage for d5uiya_ (5uiy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1993960Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 1994336Domain d5uiya_: 5uiy A: [336656]
    automated match to d1e6ia_
    complexed with epe

Details for d5uiya_

PDB Entry: 5uiy (more details), 1.69 Å

PDB Description: structure of bromodomain from human baz1a
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 1A

SCOPe Domain Sequences for d5uiya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uiya_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggvhelsafeqlvvelvrhddswpflklvskiqvpdyydiikkpialniirekvnkceyk
lasefiddielmfsncfeynprntseakagtrlqaffhiqaqklglh

SCOPe Domain Coordinates for d5uiya_:

Click to download the PDB-style file with coordinates for d5uiya_.
(The format of our PDB-style files is described here.)

Timeline for d5uiya_: