Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [336635] (1 PDB entry) |
Domain d5iu0a1: 5iu0 A:13-149 [336636] Other proteins in same PDB: d5iu0a2, d5iu0b2, d5iu0i_, d5iu0j_ automated match to d1gk8a2 complexed with cap, edo, mg |
PDB Entry: 5iu0 (more details), 1.5 Å
SCOPe Domain Sequences for d5iu0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iu0a1 d.58.9.0 (A:13-149) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} fkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtd gltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsivgnvfgfkalaa lrledlrippaytktfq
Timeline for d5iu0a1:
View in 3D Domains from other chains: (mouse over for more information) d5iu0b1, d5iu0b2, d5iu0i_, d5iu0j_ |