SCOPe 2.08: Domain d5iu0a1: 5iu0 A:13-149

Lineage for d5iu0a1 (5iu0 A:13-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [336635] (1 PDB entry)

8. Domain d5iu0a1: 5iu0 A:13-149 [336636]
   Other proteins in same PDB: d5iu0a2, d5iu0b2, d5iu0i_, d5iu0j_
   automated match to d1gk8a2
   complexed with cap, edo, mg

Details for d5iu0a1

PDB Entry: 5iu0, 1.5 Å

PDB Description: rubisco from arabidopsis thaliana

PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5iu0a1:

Sequence; same for both SEQRES and ATOM records:

>d5iu0a1 d.58.9.0 (A:13-149) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtd
gltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsivgnvfgfkalaa
lrledlrippaytktfq

Timeline for d5iu0a1:

• d5iu0a1 first appeared in SCOPe 2.06
  
• d5iu0a1 appears in SCOPe 2.07