Lineage for d5iu0a1 (5iu0 A:13-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953279Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [336635] (1 PDB entry)
  8. 2953280Domain d5iu0a1: 5iu0 A:13-149 [336636]
    Other proteins in same PDB: d5iu0a2, d5iu0b2, d5iu0i_, d5iu0j_
    automated match to d1gk8a2
    complexed with cap, edo, mg

Details for d5iu0a1

PDB Entry: 5iu0 (more details), 1.5 Å

PDB Description: rubisco from arabidopsis thaliana
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5iu0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iu0a1 d.58.9.0 (A:13-149) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fkagvkeykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtd
gltsldrykgrcyhiepvpgeetqfiayvaypldlfeegsvtnmftsivgnvfgfkalaa
lrledlrippaytktfq

SCOPe Domain Coordinates for d5iu0a1:

Click to download the PDB-style file with coordinates for d5iu0a1.
(The format of our PDB-style files is described here.)

Timeline for d5iu0a1: