SCOP 1.57: Domain d1bhl__: 1bhl -

Lineage for d1bhl__ (1bhl -)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (16 PDB entries)

8. Domain d1bhl__: 1bhl - [33662]

Details for d1bhl__

PDB Entry: 1bhl, 2.2 Å

PDB Description: cacodylated catalytic domain of hiv-1 integrase

SCOP Domain Sequences for d1bhl__:

Sequence, based on SEQRES records:

>d1bhl__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
spgiwqldxthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaaxwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records):

>d1bhl__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
spgiwqldthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtdn
gsnftsttvkaawwagikqmnkelkkiigqvrdqaehlktavqmavfihnhkrkggiggy
sagerivdiiatd

Timeline for d1bhl__:

• d1bhl__ first appeared (with stable ids) in SCOP 1.55
  
• d1bhl__ appears in SCOP 1.59
  
• d1bhl__ appears in the current release, SCOPe 2.08, called d1bhla_