Lineage for d5iu0j_ (5iu0 J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524488Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2524489Protein automated matches [336552] (6 species)
    not a true protein
  7. 2524490Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [336553] (1 PDB entry)
  8. 2524492Domain d5iu0j_: 5iu0 J: [336599]
    Other proteins in same PDB: d5iu0a1, d5iu0a2, d5iu0b1, d5iu0b2
    automated match to d1uzdc1
    complexed with cap, edo, mg

Details for d5iu0j_

PDB Entry: 5iu0 (more details), 1.5 Å

PDB Description: rubisco from arabidopsis thaliana
PDB Compounds: (J:) Ribulose bisphosphate carboxylase small chain 1B, chloroplastic

SCOPe Domain Sequences for d5iu0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iu0j_ d.73.1.0 (J:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mkvwppigkkkfetlsylpdltdvelakevdyllrnkwipcvefelehgfvyrehgntpg
yydgrywtmwklplfgctdsaqvlkeveeckkeypgafiriigfdntrqvqcisfiaykp
psf

SCOPe Domain Coordinates for d5iu0j_:

Click to download the PDB-style file with coordinates for d5iu0j_.
(The format of our PDB-style files is described here.)

Timeline for d5iu0j_: