SCOPe 2.07: Domain d5llka2: 5llk A:181-304

Lineage for d5llka2 (5llk A:181-304)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
   beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)

4. Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family)

5. Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)

6. Protein automated matches [272735] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [336597] (1 PDB entry)

8. Domain d5llka2: 5llk A:181-304 [336598]
   Other proteins in same PDB: d5llka1
   automated match to d4wiqa2
   complexed with edo

Details for d5llka2

PDB Entry: 5llk, 1.8 Å

PDB Description: crystal structure of human alpha-dystroglycan

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5llka2:

Sequence; same for both SEQRES and ATOM records:

>d5llka2 d.272.1.1 (A:181-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acaadepvtvltvildadltkmtpkqridllhrmrsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdihgveaparegamsaqlgypvvgwhia
nkkp

Timeline for d5llka2:

• d5llka2 first appeared in SCOPe 2.06
  
• d5llka2 appears in the current release, SCOPe 2.08