Lineage for d5llka2 (5llk A:181-304)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
    beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)
  4. Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family) (S)
  5. Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)
  6. Protein automated matches [272735] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [336597] (1 PDB entry)
  8. Domain d5llka2: 5llk A:181-304 [336598]
    Other proteins in same PDB: d5llka1
    automated match to d4wiqa2
    complexed with edo

Details for d5llka2

PDB Entry: 5llk (more details), 1.8 Å

PDB Description: crystal structure of human alpha-dystroglycan
PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5llka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llka2 d.272.1.1 (A:181-304) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acaadepvtvltvildadltkmtpkqridllhrmrsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdihgveaparegamsaqlgypvvgwhia
nkkp

SCOPe Domain Coordinates for d5llka2 are not available.

Timeline for d5llka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5llka1