SCOPe 2.07: Domain d5llka1: 5llk A:61-162

Lineage for d5llka1 (5llk A:61-162)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (18 PDB entries)

8. Domain d5llka1: 5llk A:61-162 [336596]
   Other proteins in same PDB: d5llka2
   automated match to d4wiqa1
   complexed with edo

Details for d5llka1

PDB Entry: 5llk, 1.8 Å

PDB Description: crystal structure of human alpha-dystroglycan

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5llka1:

Sequence; same for both SEQRES and ATOM records:

>d5llka1 b.1.6.0 (A:61-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vptvvgipdgtavvgrsfrvtiptdliassgdiikvsaagkealpswlhwdsqshtlegl
pldtdkgvhyisvsatrlgangshipqtssvfsievypedhs

Timeline for d5llka1:

• d5llka1 first appeared in SCOPe 2.06
  
• d5llka1 appears in the current release, SCOPe 2.08