![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
![]() | Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
![]() | Protein automated matches [190458] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries) |
![]() | Domain d5llka1: 5llk A:61-162 [336596] Other proteins in same PDB: d5llka2 automated match to d4wiqa1 complexed with edo |
PDB Entry: 5llk (more details), 1.8 Å
SCOPe Domain Sequences for d5llka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5llka1 b.1.6.0 (A:61-162) automated matches {Human (Homo sapiens) [TaxId: 9606]} vptvvgipdgtavvgrsfrvtiptdliassgdiikvsaagkealpswlhwdsqshtlegl pldtdkgvhyisvsatrlgangshipqtssvfsievypedhs
Timeline for d5llka1: