Lineage for d5llka1 (5llk A:61-162)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. Protein automated matches [190458] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255601] (19 PDB entries)
  8. Domain d5llka1: 5llk A:61-162 [336596]
    Other proteins in same PDB: d5llka2
    automated match to d4wiqa1
    complexed with edo

Details for d5llka1

PDB Entry: 5llk (more details), 1.8 Å

PDB Description: crystal structure of human alpha-dystroglycan
PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5llka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llka1 b.1.6.0 (A:61-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vptvvgipdgtavvgrsfrvtiptdliassgdiikvsaagkealpswlhwdsqshtlegl
pldtdkgvhyisvsatrlgangshipqtssvfsievypedhs

SCOPe Domain Coordinates for d5llka1 are not available.

Timeline for d5llka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5llka2