Lineage for d5mu9a2 (5mu9 A:156-293)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497971Family d.3.1.18: MOA C-terminal domain-like [159846] (2 proteins)
    PfamB PB070855
  6. 2497979Protein automated matches [336590] (1 species)
    not a true protein
  7. 2497980Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [336591] (1 PDB entry)
  8. 2497981Domain d5mu9a2: 5mu9 A:156-293 [336592]
    Other proteins in same PDB: d5mu9a1
    automated match to d3ef2a2
    complexed with act, ca, e64, edo, fuc, gal, gla, na

Details for d5mu9a2

PDB Entry: 5mu9 (more details), 1.3 Å

PDB Description: moa-e-64 complex
PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d5mu9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mu9a2 d.3.1.18 (A:156-293) automated matches {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy

SCOPe Domain Coordinates for d5mu9a2:

Click to download the PDB-style file with coordinates for d5mu9a2.
(The format of our PDB-style files is described here.)

Timeline for d5mu9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mu9a1