Lineage for d5mu9a1 (5mu9 A:2-155)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2061887Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2062054Protein automated matches [190608] (4 species)
    not a true protein
  7. 2062104Species Marasmius oreades [TaxId:181124] [336588] (1 PDB entry)
  8. 2062105Domain d5mu9a1: 5mu9 A:2-155 [336589]
    Other proteins in same PDB: d5mu9a2
    automated match to d3ef2a1
    complexed with act, ca, e64, edo, fuc, gal, gla, na

Details for d5mu9a1

PDB Entry: 5mu9 (more details), 1.3 Å

PDB Description: moa-e-64 complex
PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d5mu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mu9a1 b.42.2.1 (A:2-155) automated matches {Marasmius oreades [TaxId: 181124]}
slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
lanlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
vdlvngdssdgakiagwtgtwdegnphqkwyfnr

SCOPe Domain Coordinates for d5mu9a1:

Click to download the PDB-style file with coordinates for d5mu9a1.
(The format of our PDB-style files is described here.)

Timeline for d5mu9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mu9a2