Lineage for d1qs4a_ (1qs4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886120Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)
  8. 2886212Domain d1qs4a_: 1qs4 A: [33658]
    protein/DNA complex; complexed with 100, mg

Details for d1qs4a_

PDB Entry: 1qs4 (more details), 2.1 Å

PDB Description: core domain of hiv-1 integrase complexed with mg++ and 1-(5- chloroindol-3-yl)-3-hydroxy-3-(2h-tetrazol-5-yl)-propenone
PDB Compounds: (A:) protein (hiv-1 integrase (e.c.2.7.7.49))

SCOPe Domain Sequences for d1qs4a_:

Sequence, based on SEQRES records: (download)

>d1qs4a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacewggikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d1qs4a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacewggikqefgpqsqgviesmnkelkkiigqvrdqaehlktavqma
vfihnkkrkggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d1qs4a_:

Click to download the PDB-style file with coordinates for d1qs4a_.
(The format of our PDB-style files is described here.)

Timeline for d1qs4a_: