![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein automated matches [190501] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries) |
![]() | Domain d5lxfb_: 5lxf B: [336579] automated match to d1hmca_ |
PDB Entry: 5lxf (more details), 2 Å
SCOPe Domain Sequences for d5lxfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lxfb_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evseycshmigsghlqslqrlidsqmetssqitfefvdqeqlkdpvcylkkafllvqdim edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf netknlldkdwnifskncnnsfaecssqg
Timeline for d5lxfb_: