| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.16: Lipase [53555] (2 proteins) |
| Protein automated matches [254730] (4 species) not a true protein |
| Species Thermobifida cellulosilytica [TaxId:144786] [336567] (4 PDB entries) |
| Domain d5luia1: 5lui A:2-262 [336575] Other proteins in same PDB: d5luia2 automated match to d3visa_ complexed with cl, mg, peg |
PDB Entry: 5lui (more details), 1.5 Å
SCOPe Domain Sequences for d5luia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5luia1 c.69.1.16 (A:2-262) automated matches {Thermobifida cellulosilytica [TaxId: 144786]}
anpyergpnptdalleassgpfsvseenvsrlsasgfgggtiyyprenntygavaispgy
tgteasiawlgeriashgfvvitidtittldqpdsraeqlnaalnhminrasstvrsrid
ssrlavmghsmggggtlrlasqrpdlkaaipltpwhlnknwssvtvptliigadldtiap
vathakpfynslpssiskayleldgathfapnipnkiigkysvawlkrfvdndtrytqfl
cpgprdglfgeveeyrstcpf
Timeline for d5luia1: