Lineage for d5luia1 (5lui A:2-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900720Family c.69.1.16: Lipase [53555] (2 proteins)
  6. 2900725Protein automated matches [254730] (4 species)
    not a true protein
  7. 2900747Species Thermobifida cellulosilytica [TaxId:144786] [336567] (4 PDB entries)
  8. 2900749Domain d5luia1: 5lui A:2-262 [336575]
    Other proteins in same PDB: d5luia2
    automated match to d3visa_
    complexed with cl, mg, peg

Details for d5luia1

PDB Entry: 5lui (more details), 1.5 Å

PDB Description: structure of cutinase 1 from thermobifida cellulosilytica
PDB Compounds: (A:) Cutinase 1

SCOPe Domain Sequences for d5luia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5luia1 c.69.1.16 (A:2-262) automated matches {Thermobifida cellulosilytica [TaxId: 144786]}
anpyergpnptdalleassgpfsvseenvsrlsasgfgggtiyyprenntygavaispgy
tgteasiawlgeriashgfvvitidtittldqpdsraeqlnaalnhminrasstvrsrid
ssrlavmghsmggggtlrlasqrpdlkaaipltpwhlnknwssvtvptliigadldtiap
vathakpfynslpssiskayleldgathfapnipnkiigkysvawlkrfvdndtrytqfl
cpgprdglfgeveeyrstcpf

SCOPe Domain Coordinates for d5luia1:

Click to download the PDB-style file with coordinates for d5luia1.
(The format of our PDB-style files is described here.)

Timeline for d5luia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5luia2