SCOPe 2.08: Domain d5luia1: 5lui A:2-262

Lineage for d5luia1 (5lui A:2-262)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.16: Lipase [53555] (2 proteins)

6. Protein automated matches [254730] (4 species)
   not a true protein

7. Species Thermobifida cellulosilytica [TaxId:144786] [336567] (4 PDB entries)

8. Domain d5luia1: 5lui A:2-262 [336575]
   Other proteins in same PDB: d5luia2
   automated match to d3visa_
   complexed with cl, mg, peg

Details for d5luia1

PDB Entry: 5lui, 1.5 Å

PDB Description: structure of cutinase 1 from thermobifida cellulosilytica

PDB Compounds: (A:) Cutinase 1

SCOPe Domain Sequences for d5luia1:

Sequence; same for both SEQRES and ATOM records:

>d5luia1 c.69.1.16 (A:2-262) automated matches {Thermobifida cellulosilytica [TaxId: 144786]}
anpyergpnptdalleassgpfsvseenvsrlsasgfgggtiyyprenntygavaispgy
tgteasiawlgeriashgfvvitidtittldqpdsraeqlnaalnhminrasstvrsrid
ssrlavmghsmggggtlrlasqrpdlkaaipltpwhlnknwssvtvptliigadldtiap
vathakpfynslpssiskayleldgathfapnipnkiigkysvawlkrfvdndtrytqfl
cpgprdglfgeveeyrstcpf

Timeline for d5luia1:

• d5luia1 first appeared in SCOPe 2.06
  
• d5luia1 appears in SCOPe 2.07