Lineage for d5gs8a_ (5gs8 A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. Protein automated matches [190857] (70 species)
    not a true protein
  7. Species Serratia marcescens [TaxId:615] [327556] (4 PDB entries)
  8. Domain d5gs8a_: 5gs8 A: [336561]
    automated match to d1buea_
    complexed with cl, na, so4

Details for d5gs8a_

PDB Entry: 5gs8 (more details), 1.59 Å

PDB Description: crystal structure of tla-3 extended-spectrum beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5gs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gs8a_ e.3.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
gtdslknsiekylkdkkakvgvavlgiednfklnvnekhhypmqstykfhlalavldkld
kenisvdkklfvkksdlqpntwsplkdkypngnlelsfseiikstvshsdnngcdilfrf
vggtnkvhnfisklgvknisikateeemhkawnvqytnwttpdatvqllkkfykneilsk
nsydfllntmietttgpkrlkgllpdgtvvahktgssdtnnkgitaatndigiitlpngk
hfaiavyvsdsseksdvnekiiaeicksvwdylvk

SCOPe Domain Coordinates for d5gs8a_ are not available.

Timeline for d5gs8a_: