SCOPe 2.05: Domain d1bl3b_: 1bl3 B:

Lineage for d1bl3b_ (1bl3 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries)

8. Domain d1bl3b_: 1bl3 B: [33656]
   complexed with mg

Details for d1bl3b_

PDB Entry: 1bl3, 2 Å

PDB Description: catalytic domain of hiv-1 integrase

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1bl3b_:

Sequence, based on SEQRES records:

>d1bl3b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d1bl3b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefviesmnkelkkiigqvrdqaehlktavqmavfihnhk
rkggiggysagerivdiiatdiq

Timeline for d1bl3b_:

• d1bl3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bl3b_ appears in SCOPe 2.04
  
• d1bl3b_ appears in SCOPe 2.06
  
• d1bl3b_ appears in the current release, SCOPe 2.08