Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:196627] [336548] (2 PDB entries) |
Domain d5gwea_: 5gwe A: [336550] automated match to d4mm0b_ complexed with gwm, hem, so4 |
PDB Entry: 5gwe (more details), 2 Å
SCOPe Domain Sequences for d5gwea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gwea_ a.104.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]} tshhgyqpfdmhnpfpaykelrqeepvmfderigywvvtkyddikttfddwetfssenaq apvrkrgpqatqimtdggftaysglsarippehtriraiaqkaftprrykalepdiramv idrvekmlandqhvgdmvsdlaydiptitiltligadismvdtykrwsdsraamtwgdls deeqiphahnlveywqecqrmvadahahggdnltadlvraqqegqeitdheiasllysll faghettttlisncfrvlldhpeqwqailenpklipaavdevlrysgsivgwrrkalkdt eiggvaikegdgvlllmgsanrdearfengeefdisranarehlsfgfgihyclgnmlak lqakicleevtrlvpslhlvadkaigfrenlsfrvptsvpvtwna
Timeline for d5gwea_: