Lineage for d5gwea_ (5gwe A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331727Species Corynebacterium glutamicum [TaxId:196627] [336548] (2 PDB entries)
  8. 2331729Domain d5gwea_: 5gwe A: [336550]
    automated match to d4mm0b_
    complexed with gwm, hem, so4

Details for d5gwea_

PDB Entry: 5gwe (more details), 2 Å

PDB Description: cytochrome p450 crej
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d5gwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gwea_ a.104.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tshhgyqpfdmhnpfpaykelrqeepvmfderigywvvtkyddikttfddwetfssenaq
apvrkrgpqatqimtdggftaysglsarippehtriraiaqkaftprrykalepdiramv
idrvekmlandqhvgdmvsdlaydiptitiltligadismvdtykrwsdsraamtwgdls
deeqiphahnlveywqecqrmvadahahggdnltadlvraqqegqeitdheiasllysll
faghettttlisncfrvlldhpeqwqailenpklipaavdevlrysgsivgwrrkalkdt
eiggvaikegdgvlllmgsanrdearfengeefdisranarehlsfgfgihyclgnmlak
lqakicleevtrlvpslhlvadkaigfrenlsfrvptsvpvtwna

SCOPe Domain Coordinates for d5gwea_:

Click to download the PDB-style file with coordinates for d5gwea_.
(The format of our PDB-style files is described here.)

Timeline for d5gwea_: