![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Deinococcus radiodurans [TaxId:243230] [336537] (1 PDB entry) |
![]() | Domain d5givc_: 5giv C: [336546] automated match to d1wgza_ complexed with act, zn |
PDB Entry: 5giv (more details), 2.4 Å
SCOPe Domain Sequences for d5givc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5givc_ d.92.1.0 (C:) automated matches {Deinococcus radiodurans [TaxId: 243230]} qwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharatdagygk lldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtearpandf grmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraalvplad aviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlgghdvri ttrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlwenlvgr srafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvitrfele remlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgytignvl saqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgqaltagp ylkylrgkygelygv
Timeline for d5givc_: