SCOPe 2.05: Domain d1b92a_: 1b92 A:

Lineage for d1b92a_ (1b92 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries)

8. Domain d1b92a_: 1b92 A: [33654]
   complexed with cac, so4

Details for d1b92a_

PDB Entry: 1b92, 2.02 Å

PDB Description: mobility of an hiv-1 integrase active site loop is correlated with catalytic activity

PDB Compounds: (A:) protein (integrase)

SCOPe Domain Sequences for d1b92a_:

Sequence, based on SEQRES records:

>d1b92a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgipynpqsqaviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records):

>d1b92a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgaviesmnkelkkiigqvrdqaehlktavqmavfih
nkkrkggysagerivdiiatdiqt

Timeline for d1b92a_:

• d1b92a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b92a_ appears in SCOPe 2.04
  
• d1b92a_ appears in SCOPe 2.06
  
• d1b92a_ appears in the current release, SCOPe 2.08