SCOPe 2.06: Domain d5tviw_: 5tvi W:

Lineage for d5tviw_ (5tvi W:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (6 species)
   not a true protein

7. Species Solanum melongena [TaxId:4111] [336505] (1 PDB entry)

8. Domain d5tviw_: 5tvi W: [336515]
   automated match to d1rzla_
   complexed with gol, myr, o8n

Details for d5tviw_

PDB Entry: 5tvi, 1.87 Å

PDB Description: crystal structure of non-specific lipid transfer protein reveals non- canonical lipid binding: possible relevance in modulating allergenicity

PDB Compounds: (W:) non specific lipid transfer protein

SCOPe Domain Sequences for d5tviw_:

Sequence; same for both SEQRES and ATOM records:

>d5tviw_ a.52.1.0 (W:) automated matches {Solanum melongena [TaxId: 4111]}
avtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanryp
nlkddaaqslpskcgislnvpisrtincdtis

Timeline for d5tviw_:

• d5tviw_ is new in SCOPe 2.06-stable
  
• d5tviw_ appears in SCOPe 2.07
  
• d5tviw_ appears in the current release, SCOPe 2.08