Lineage for d5tviw_ (5tvi W:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000589Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2000590Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2000673Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2000674Protein automated matches [254428] (6 species)
    not a true protein
  7. 2000686Species Solanum melongena [TaxId:4111] [336505] (1 PDB entry)
  8. 2000688Domain d5tviw_: 5tvi W: [336515]
    automated match to d1rzla_
    complexed with gol, myr, o8n

Details for d5tviw_

PDB Entry: 5tvi (more details), 1.87 Å

PDB Description: crystal structure of non-specific lipid transfer protein reveals non- canonical lipid binding: possible relevance in modulating allergenicity
PDB Compounds: (W:) non specific lipid transfer protein

SCOPe Domain Sequences for d5tviw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tviw_ a.52.1.0 (W:) automated matches {Solanum melongena [TaxId: 4111]}
avtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanryp
nlkddaaqslpskcgislnvpisrtincdtis

SCOPe Domain Coordinates for d5tviw_:

Click to download the PDB-style file with coordinates for d5tviw_.
(The format of our PDB-style files is described here.)

Timeline for d5tviw_: