SCOPe 2.08: Domain d5tviv_: 5tvi V:

Lineage for d5tviv_ (5tvi V:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Solanum melongena [TaxId:4111] [336505] (5 PDB entries)

8. Domain d5tviv_: 5tvi V: [336506]
   automated match to d1rzla_
   complexed with gol, myr, o8n

Details for d5tviv_

PDB Entry: 5tvi, 1.87 Å

PDB Description: crystal structure of non-specific lipid transfer protein reveals non- canonical lipid binding: possible relevance in modulating allergenicity

PDB Compounds: (V:) non specific lipid transfer protein

SCOPe Domain Sequences for d5tviv_:

Sequence; same for both SEQRES and ATOM records:

>d5tviv_ a.52.1.0 (V:) automated matches {Solanum melongena [TaxId: 4111]}
vtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanrypn
lkddaaqslpskcgislnvpisrtincdti

Timeline for d5tviv_:

• d5tviv_ first appeared in SCOPe 2.06
  
• d5tviv_ appears in SCOPe 2.07