![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.0: automated matches [254196] (1 protein) not a true family |
![]() | Protein automated matches [254428] (8 species) not a true protein |
![]() | Species Solanum melongena [TaxId:4111] [336505] (5 PDB entries) |
![]() | Domain d5tviv_: 5tvi V: [336506] automated match to d1rzla_ complexed with gol, myr, o8n |
PDB Entry: 5tvi (more details), 1.87 Å
SCOPe Domain Sequences for d5tviv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tviv_ a.52.1.0 (V:) automated matches {Solanum melongena [TaxId: 4111]} vtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanrypn lkddaaqslpskcgislnvpisrtincdti
Timeline for d5tviv_: